FABP5 (Fatty Acid-Binding Protein, Epidermal, Epidermal-Type Fatty Acid-Binding Protein, E-FABP, Fatty Acid-Binding Protein 5, Psoriasis-Associated Fatty Acid-Binding Protein Homolog, PA-FABP)

Größe

£620.00

SKU:: 397409
Reinheit:: Purified by immunoaffinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to a sequence KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD of human FABP5.
Format:: Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Weitere Details:: FABP5, Fatty acid-binding protein, epidermal, is a protein that in humans is encoded by the FABP5 gene. This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. It is mapped to 8q21.13. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Applications: Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Versandbedingungen:: Blue Ice