377516
MVD
Größe
£620.00
- SKU:
- 377516
- Anwendung:
- WB
- Reinheit:
- Purified by immunoaffinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to KDFTEDRIWLNGREEDVGQPRLQACLREIRCLARKRR from human MVD.
- Format:
- Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
- Weitere Details:
- The enzyme mevalonate pyrophosphate decarboxylase (MVD; EC 4.1.1.33) catalyzes the conversion of mevalonate pyrophosphate into isopentenyl pyrophosphate. This unusual enzyme decarboxylates and dehydrates its substrate while hydrolyzing ATP. As a unique enzyme in one of the early steps in cholesterol biosynthesis, MVD may be a useful target for drugs aimed at lowering serum cholesterol levels. This gene is mapped to chromosome 16q24.3 based on an alignment of the MVD sequence. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice