377212
ADAM2 (Disintegrin and Metalloproteinase Domain-containing pP
Größe
£620.00
- SKU:
- 377212
- Anwendung:
- WB
- Reinheit:
- Purified by immunoaffinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa231-274, WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK from human ADAM2 at N-terminal, different from the related mouse and rat sequences by 11aa.
- Format:
- Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
- Weitere Details:
- ADAM2 (A Disintegrin and Metalloproteinase Domain 2), also known as FTNB or PH30, is an enzyme that in humans is encoded by the ADAM2 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene is mapped to 8p11.2. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice