ZNF267 (HZF2, Zinc Finger Protein 267)

Größe

£685.00

SKU:: 377196
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa132-230 from partial human ZNF267, fused to GST-Tag.
Klon:: 7D18
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: KTFKYDQFDESSVESLFHQQILSSCAKSYNFDQYRKV FTHSSLLNQQEEIDIWGKHHIYDKTSVLFRQVSTLNSY RNVFIGEKNYHCNNSEKTLNQSSS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.