SCGB2A1 (Mammaglobin-B, LPHC, MGB2, UGB3, Secretoglobin, Family 2A, Member 1)

Größe

£685.00

SKU:: 377179
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-195 from full-length human SCGB2A1, fused to GST-Tag.
Klon:: 2E2
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: May bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISI PEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKN FGLMMHTVYDSIWCNMKSN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.