PLA2G2A (MOM1, PLA2, PLA2B, PLA2L, PLA2S, PLAS1, sPLA2, Phospholipase A2, Group IIA (Platelets, Synovial Fluid)

Größe

£685.00

SKU:: 377177
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa1-144 from human PLA2G2A with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2E8
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA2, an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides, releasing free fatty acids and lysophospholipids, and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5' UTRs have been found for this gene Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAAL SYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLE KRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDK AAATCSARNKTTYNKKYQYYSNKHCRGSTPRC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice