377172
PDCD1LG2 (B7DC, Btdc, CD273, PD-L2, PDCD1L2, PDL2, Programmed Cell Death 1 Ligand 2)
Größe
£685.00
- SKU:
- 377172
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa19-121 from partial human PDCD1LG2, fused to GST-Tag.
- Klon:
- 1E9
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: ALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITA SLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVR DEGQYQCIIIYGVAWDYKYLTLKVKA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice