MSRA (Methionine Sulfoxide Reductase A)

Größe

£698.00

SKU:: 377170
Reinheit:: Purified
Lagerbedingungen:: 0°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-100 from partial human MSRA, fused to GST-Tag.
Klon:: 3C11
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALP GRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMG CFWGAERKFWVLKGVYSTQVGFAGGYT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.