MGAT2 (CDGS2, GLCNACTII, GNT-II, GNT2, Mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase)

Größe

£685.00

SKU:: 377168
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-447 from full-length human MGAT2, fused to GST-Tag.
Klon:: 6G5
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: The product of this gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in this gene may lead to carbohydrate-deficient glycoprotein syndrome, type II. The coding region of this gene is intronless. Transcript variants with a spliced 5' UTR may exist, but their biological validity has not been determined. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALA PPLLDAEPARGAGGRGGDHPSVAVGIRRVSNVSAASL VPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGT WAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVI FSHDFWSTEINQLIAGVNFCPVLQVFFPFSIQLYPNEFP GSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAK FSQTKHHWWWKLHFVWERVKILRDYAGLILFLEEDHY LAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF YGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDT FCTYDDYNWDWTLQYLTVSCLPKFWKVLVPQIPRIFH AGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETL TISEKFTVVAISPPRKNGGWGDIRDHELCKSYRRLQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice