377155
GRIK2 (EAA4, GLR6, GLUK6, GLUR6, MRT6, Glutamate Receptor, Ionotropic Kainate 2)
Größe
£728.00
- SKU:
- 377155
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Recombinant protein corresponding to aa1-583 from full-length human GRIK2, fused to GST-Tag.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing at multiple sites within the first and second transmembrane domains, which is thought to alter the structure and function of the receptor complex. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene. Mutations in this gene have been associated with autosomal recessive mental retardation. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFG GIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLT YDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSA NAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPD FSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKA PSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFD CSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVE PYRYSGVNMTGFRILNTENTQVSSIIEKWSMERLQAPP KPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMT VSSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGRITFN KTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTES QKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYG NDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDA NGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKP FMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAY LGVSCVLFVIARS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice