EFEMP2 (FBLN4, MBP1, UPH1, EGF-Containing Fibulin-Like Extracellular Matrix Protein 2)

Größe

£685.00

SKU:: 377149
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa26-443 from human EFEMP2, fused to GST-Tag.
Klon:: 3E5
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation, activation of complement and determination of cell fate during development. The protein encoded by this gene contains four EGF2 domains and six calcium-binding EGF2 domains. This gene is necessary for elastic fiber formation and connective tissue development. Defects in this gene are cause of an autosomal recessive cutis laxa syndrome. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: SPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLTI PEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPP PVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDC RPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYR YCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNEC DMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSD IDECSYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRL CQDIDECESGAHQCSEAQTCVNFHGGYRCVDTNRCV EPYIQVSENRCLCPASNPLCREQPSSIVHRYMTITSER SVPADVFQIQATSVYPGAYNAFQIRAGNSQGDFYIRQI NNVSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRAS SVLRLTVFVGAYTF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice