DSCR6 (RIPPLY3, Down Syndrome Critical Region Gene 6)

Größe

£685.00

SKU:: 377145
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant protein corresponding to aa1-190 from human DSCR6. MW of the GST-Tag alone is ~26kD.
Klon:: 1D1
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Acts as a transcriptional corepressor. Negative regulator of the transcriptional activity of TBX1. Plays a role in the development of the pharyngeal apparatus and derivatives (By similarity). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPES PAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSKG AFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQAT IDFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQE NGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGV SSRGGKCSSSK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.