CEP57 (KIAA0092, PIG8, TSP57)

Größe

£685.00

SKU:: 377143
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa19-128 from partial human CEP57, fused to GST-Tag.
Klon:: 1E9
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Translokin binds basic fibroblast growth factor (FGF2) and mediates its nuclear translocation and mitogenic activity Applications: Suitable for use in ELISA, Western Blot, Immunofluorescence. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: AEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.