YkuP, Recombinant, Bacillus Subtilis, aa1-151, His-SUMO-Tag (Probable Flavodoxin-2)

Größe

£633.00

SKU:: 375893
Molekulargewicht:: 32.6
Reinheit:: ≥90% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: Low-potential electron donor to a number of redox enzymes. Curated. Source: Recombinant protein corresponding to aa1-151 from bacillus subtilis Probable Flavodoxin-2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.6kD Amino Acid Sequence: MAKILLVYATMSGNTEAMADLIEKGLQEALAEVDRFEAMDIDDAQLFTDYDHVIMGTYTWGDGDLPDEFLDLVEDMEEIDFSGKTCAVFGSGDTAYEFFCGAVDTLEAKIKERGGDIVLPSVKIENNPEGEEEEELINFGRQFAKKSGCAV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.