XCL1, Recombinant, Human, aa22-114, His-Tag (Lymphotactin Protein)

Größe

£486.00

SKU:: 375878
Molekulargewicht:: 14.3
Reinheit:: ≥90% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: Chemotactic activity for lymphocytes but not for monocytes or neutrophils. Source: Recombinant protein corresponding to aa22-114 from human Lymphotactin Protein, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.3kD Amino Acid Sequence: VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.