SOD1, Recombinant, Mouse, aa2-154, His-Tag (Superoxide Dismutase [Cu-Zn])

Größe

£512.00

SKU:: 375370
Molekulargewicht:: 17.8
Reinheit:: ≥90% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: Destroys radicals which are normally produced within the cells and which are toxic to biological systems. Source: Recombinant protein corresponding to aa2-154 from mouse SOD1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.8kD Amino Acid Sequence: AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.