SEPP1, Recombinant, Bovine, aa20-402, GST-Tag (Selenoprotein P)

Größe

£633.00

SKU:: 375249
Molekulargewicht:: 70.1
Reinheit:: ~90% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: Constitutes a major selenium pool in the brain and may play an important role in developing and/or modulating the morphology of neurons and/or glial cells. Source: Recombinant protein corresponding to aa20-402 from bovine SEPP1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~70.1kD Amino Acid Sequence: ESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASUYLCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQPDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLKALEDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLSESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGHSDNCDTPVGSESLQPSLPQKKLURKRCINQLLUQFPKDSESALSSCCCHCRHLVFEKTGSAITUQCTEKLPSLCSUQGLLAEENVIESUQURLPPAAUQAAGQQLNPTEASTKUSUKNKAKMUKUPSN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.