375187
SAA1, Recombinant, Equine, aa1-110, His-Tag (Serum Amyloid A)
Größe
£570.00
- SKU:
- 375187
- Molekulargewicht:
- 14.3
- Reinheit:
- ≥90% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Weitere Details:
- Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa1-110 from equine SAA1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~14.3kD Amino Acid Sequence: LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice