NTF4, Recombinant, Human, aa82-210, His-Tag (Neurotrophin-4)

Größe

£429.00

SKU:: 374486
Molekulargewicht:: 17.9
Reinheit:: ≥90% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: Target-derived survival factor for peripheral sensory sympathetic neurons. Full length recombinant protein corresponding to aa82-210 from human Neurotrophin-4, fused to His-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot: P34130 Molecular Weight: ~17.9kD Amino Acid Sequence: VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.