Mt2, Recombinant, Danio rerio, aa1-60, His-Tag (Metallothionein-2)

Größe

£570.00

SKU:: 374299
Molekulargewicht:: 8
Reinheit:: ≥90% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: Metallothioneins have a high content of cysteine residues that bind various heavy metals. Source: Recombinant full length protein corresponding to aa1-60 from danio rerio Metallothionein-2, fused to 6xHis-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~8kD Amino Acid Sequence: MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.