MS4A1, Recombinant, Mouse, aa111-291, His-Tag (B-lymphocyte Antigen CD20, Ms4a1)

Größe

£555.00

SKU:: 374280
Molekulargewicht:: 22.3
Reinheit:: ≥95% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.
Weitere Details:: This protein may be involved in the regulation of B-cell activation and proliferation. Partial recombinant protein corresponding to aa111-291 from mouse MS4A1, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~22.3kD Amino Acid Sequence: VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.