LRP2, Recombinant, Human, aa1186-1389, His-Tag (Low-density Lipoprotein Receptor-related Protein 2)

Größe

£448.00

SKU:: 374081
Molekulargewicht:: 24.2
Reinheit:: ≥85% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: Acts together with cubilin to mediate HDL endocytosis. May participate in regulation of parathyroid-hormone and para-thyroid-hormone-related protein release. Source: Recombinant protein corresponding to aa1186-1389 from human LRP2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~24.2kD Amino Acid Sequence: NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.