LMO1, Recombinant, Human, aa5-156, GST-Tag (Rhombotin-1)

Größe

£486.00

SKU:: 374059
Molekulargewicht:: 44.4
Reinheit:: ≥90% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. Source: Recombinant protein corresponding to aa5-156 from human LMO1, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~44.4kD Amino Acid Sequence: DKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.