372826
COL4A1, Recombinant, Human, aa30-167, GST-Tag (Collagen alpha-1(IV) Chain)
Größe
£429.00
- SKU:
- 372826
- Molekulargewicht:
- 39.9
- Reinheit:
- ≥90% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Weitere Details:
- Type IV collagen is the major structural component of glomerular basent membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Arresten, comprising the C-terminal NC1 domain, inhibits angiogenesis and tumor formation. The C-terminal half is found to possess the anti-angiogenic activity. Specifically inhibits endothelial cell proliferation, migration and tube formation. Inhibits expression of hypoxia-inducible factor 1alpha and ERK1/2 and p38 MAPK activation. Ligand for alpha1/beta1 integrin. Source: Recombinant protein corresponding to aa30-167 from human COL4A1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.9kD Amino Acid Sequence: GCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice