372799
CMA1, Recombinant, Human, aa22-247, His-Tag (Chymase)
Größe
£555.00
- SKU:
- 372799
- Molekulargewicht:
- 29
- Reinheit:
- ≥90% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 10mM Tris,-HCl, 1mM EDTA, 6% Trehalose, pH8.0. Reconstitute with sterile ddH2O to 0.1-1mg/ml.
- Weitere Details:
- Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular domain matrix degradation, and regulation of gland secretion. Recombinant protein corresponding to aa22-247 from human CMA1, fused to 6xHis-B2M tagged N-terminal, expressed in E. coli. Swiss/UniProt Accession: P23946.. Molecular Weight: ~29.0kD Amino Acid Sequence: IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice