372666
Cd3e, Recombinant, Mouse, aa23-108, His-Tag (T-Cell surface Glycoprotein CD3 epsilon Chain)
Größe
£453.00
- SKU:
- 372666
- Molekulargewicht:
- 11.9
- Reinheit:
- ≥90% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Weitere Details:
- The CD3 complex mediates signal transduction, resulting in T cell activation and proliferation. Required for normal immune responses. Partial recombinant protein corresponding to aa23-108 from mouse Cd3e, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.9kD Amino Acid Sequence: DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice