372092
50S Ribosomal Protein L7/L12, Recombinant, Staphylococcus Aureus, aa1-122, His-SUMO-Tag (RplL)
Größe
£633.00
- SKU:
- 372092
- Molekulargewicht:
- 28.7
- Reinheit:
- ≥90% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Weitere Details:
- Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation. Source: Recombinant protein corresponding to aa1-122 from staphylococcus aureus 50S Ribosomal Protein L7/L12, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.7kD Amino Acid Sequence: MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVELTSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVELK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice