FGF-15, Recombinant, Mouse, aa26-218, His-SUMO-Tag (Fibroblast Growth Factor 15)

Größe

£555.00

SKU:: 370612
Molekulargewicht:: 38.5
Reinheit:: ≥90% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.
Weitere Details:: Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression. Recombinant protein corresponding to aa26-218 from mouse FGF-15, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Uniprot/Swiss Accession: O35622. Molecular Weight: ~38.5kD Amino Acid Sequence: RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.