Ferritin-2, Chloroplastic, Recombinant, Glycine Max, aa52-257, His-SUMO-Tag (SFerH-2)

Größe

£633.00

SKU:: 370611
Molekulargewicht:: 39.53
Reinheit:: ≥90% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Source: Recombinant protein corresponding to aa52-257 from Glycine max Ferritin-2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.53kD Amino Acid Sequence: APAPLAGVIFEPFQELKKDYLAVPIAHNVXLARQNYADDSESAINEQINVEYNVSYVYHALFAYFDRDNIALKGLAKFFKESSEEEREHAEQLIKYQNIRGGRVVLHPITSPPSEFEHSEKGDALYAMELALSLEKLTNEKLLHVHSVAERNNDPQXADFIESEFLYEQVKSIKKIAEYVAQLRLVGKGHGVWHFDQKLLHDEDHV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.