UCHL5IP (UCHL5-interacting Protein, HSXQ28ORF, UIP1)

Größe

£685.00

SKU:: 368486
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: UCHL5IP (NP_059988.3, aa1-368) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2F2
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFMDQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDWQWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLILAFLQVYDDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWGGSSSVMSLATKMNELMEK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.