TMSB15A (Thymosin-like Protein 8, TMSL8, TMSNB, Tb15, TbNB)

Größe

£685.00

SKU:: 368357
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: TMSB15A (NP_068832.1, aa1-45) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6D10
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.