368331
SERPINA3 (AACT, ACT, GIG24, GIG25, Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 3)
Größe
£698.00
- SKU:
- 368331
- Reinheit:
- Ascites
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- SERPINA3 (AAH03559, aa25-423) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1E6
- Format:
- Supplied as a liquid.
- Weitere Details:
- The protein encoded by this gene is a plasma protease inhibitor and member of the serine protease inhibitor class. Polymorphisms in this protein appear to be tissue specific and influence protease targeting. Variations in this protein's sequence have been implicated in Alzheimer's disease, and deficiency of this protein has been associated with liver disease. Mutations have been identified in patients with Parkinson disease and chronic obstructive pulmonary disease. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLY KQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILK GLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGN AMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAA KKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKA KWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTI PYFRDEELSCTVVELKYTGNASALFILPDQDKMEEVEA MLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDIL LQLGIEEAFTSKADLSGITGARNLAVSQVVHKAVLDVF EEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPT DTQNIFFMSKVTNPKQA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice