SCGB2A2 (Mammaglobin A, Mammaglobin-A, Mammaglobin-1, Secretoglobin Family 2A Member 2, MGB1, UGB2)

Größe

£685.00

SKU:: 368329
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: SCGB2A2 (NP_002402.1, aa1-93) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A4
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Mammary gland specific. Over-expressed in breast cancer. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNV EVFMQLIYDSSLCDLF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.