SCGB2A1 (Mammaglobin-B, Lacryglobin, Lipophilin-C, Mammaglobin-2, Secretoglobin Family 2A Member 1, LPHC, MGB2, UGB3)

Größe

£685.00

SKU:: 368328
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: SCGB2A1 (NP_002398.1, aa1-95) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1G10
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: May bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEHPMKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKN FGLMMHTVYDSIWCNMKSN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.