REG3A (Regenerating Islet-derived Protein 3-alpha, Human Proislet Peptide, Pancreatitis-associated Protein 1, Regenerating Islet-derived Protein III-alpha, HIP, INGAP, PAP, PAP-H, PAP1, PBCGF, REG-III, REG3)

Größe

£685.00

SKU:: 368322
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: REG3A (AAH36776.1, aa1-175) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1H4
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. Multiple alternatively spliced transcript variants encoding the same protein have been described for this gene but the full length nature of some transcripts is not yet known. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution:: Optimal dilutions to be determined by the researcher. AA Sequence: MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.