NGFR (Tumor Necrosis Factor Receptor Superfamily Member 16, Low Affinity Neurotrophin Receptor p75NTR, Low-affinity Nerve Growth Factor Receptor, CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR)

Größe

£685.00

SKU:: 368268
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: NGFR (AAH50309.1, aa65-148) partial recombinant protein with GST tag.
Klon:: 2C8
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Nerve growth factor receptor contains an extracellular domain containing four 40aa repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155aa cytoplasmic domain. The cysteine-rich region contains the nerve growth factor binding domain. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution:: Optimal dilutions to be determined by the researcher. AA Sequence: EPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEEGGGGS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.