IFT74 (Intraflagellar Transport Protein 74 Homolog, Capillary Morphogenesis Gene 1 Protein, CCDC2, CMG-1, CMG1)

Größe

£685.00

SKU:: 368170
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: IFT74 (NP_079379, aa1-100) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B6
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Component of the intraflagellar transport (IFT) complex B: together with IFT81, forms a tubulin-binding module that specifically mediates transport of tubulin within the cilium. Binds beta-tubulin via its basic region. Required for ciliogenesis. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEEVMNGYNMLKAQNDRETQSLDVIFTERQAKEKQIRSVEEEIEQEKQATDDIIKNMSLENQVKYLEMKTTNEKLLQELDTLQQQLDSQNMKKESLEAEI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.