HYKK (Hydroxylysine Kinase, 5-hydroxy-L-lysine Kinase, Aminoglycoside Phosphotransferase Domain-Containing Protein 1, AGPHD1)

Größe

£685.00

SKU:: 368164
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: HYKK (ENSP00000353710, aa1-172) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F2
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Catalyzes the GTP-dependent phosphorylation of 5- hydroxy-L-lysine. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPTEYVLKISNTKASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKSYLVRLLTYLPGRPIAELPVSPQLLYEIGKLAAKLDKTLQEGKPRVTPLLAKN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.