GLYATL2 (BXMAS2-10, GATF-B, Glycine-N-acyltransferase-like 2)

Größe

£685.00

SKU:: 368152
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: GLYATL2 (AAH16789.1, aa1-294) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C5
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: GLYATL2 belongs to the glycine N-acyltransferase family. This protein is expressed at highest levels in salivary gland and trachea. It is a mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. GLYATL2 conjugates numerous substrates, such as arachidonoyl-CoA and saturated medium and long-chain acyl-CoAs ranging from chain-length C8:0-CoA to C18:0-CoA, to form a variety of N-acylglycines. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDHYTNTYHIFTKASDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKKGNFSNMFIDASHAGLVNEHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice