368091
DDX60 (Probable ATP-Dependent RNA Helicase DDX60, DEAD Box Protein 60)
Größe
£685.00
- SKU:
- 368091
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- DDX60 (AAH20601.1, aa1-183) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1A10
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- DDX60 is a DEXD/H Box RNA helicase and the human homolog of the S. cerevisiae Ski2, a cofactor of RNA exosome. Expression of DDX60 increases after viral infection and binds to endogenous RIG-I, a cytoplasmic viral RNA sensor, as well as other RIG-I-like receptors such as MDA5 and LGP2. These proteins activate TBK1 and IKK-e, signaling IRF3 and NF-kB-responsive genes in the innate immune response pathway. DDX60 is required for the RIG-I- or MDA5- dependent response to viral infection, but is dispensable for TLR3-mediated signalin. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKIMEDFTTFLRIVSKLADMNQEYQLPLSKIKFTGKECEDSQLVSHLMSCKEGRVAISPFVCLSGNFDDDLLRLETPNHVTLGTIGVNRSQAPVLLSQKFDNRGRKMSLNAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSISVSLRELCENEDDNVVLAFEQLSTTFWEKLNKV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice