DCLK3 (Doublecortin-like and CAM kinase-like 3, Doublecortin-like Kinase 3, DCAMKL3, DCDC3C, KIAA1765)

Größe

£685.00

SKU:: 368090
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: DCLK3 (NP_208382.1, aa175-284) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B1
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.