AVPI1 (PP5395, Arginine Vasopressin-induced Protein 1, VIP32, VIT32)

Größe

£685.00

SKU:: 367986
Reinheit:: Purified.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant protein corresponding to aa1-147 of human AVPI1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1G3
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: May be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling (By similarity). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTSYLHQIRH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.