ARHGEF18 (Rho Guanine Nucleotide Exchange Factor 18, KIAA0521, P114-RhoGEF)

Größe

£685.00

SKU:: 367982
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: ARHGEF18 (AAH08016.1, aa1-89) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 8H6
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Rho GTPases are GTP binding proteins that regulate a wide spectrum of cellular functions. These cellular processes include cytoskeletal rearrangements, gene transcription, cell growth and motility. Activation of Rho GTPases is under the direct control of guanine nucleotide exchange factors (GEFs). The protein encoded by this gene is a guanine nucleotide exchange factor and belongs to the Rho GTPase GFE family. Family members share a common feature, a Dbl (DH) homology domain followed by a pleckstrin (PH) homology domain. Alternatively spliced transcript variants encoding different isoforms have been identified. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSQGMQRMHLETLQQVDKWPLCGPLACSELLQTVRSLEGWRKEVLGSIKGAGTSQGGEIHPRSSSGGERAHVKPCSAPQALVVGLGPG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.