UBE2Q2 (Ubiquitin-conjugating Enzyme E2 Q2, LOC92912, UB2Q2, Ubiquitin Carrier Protein Q2, Ubiquitin-Protein Ligase Q2)

Größe

£620.00

SKU:: 353321
Reinheit:: Purified by immunoaffinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to aa83-123, LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ, of human UBE2Q2 at N-terminal, different from the related mouse sequence by 4aa.
Format:: Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
Weitere Details:: UBE2Q2 is identified as a putative ubiquitin-conjugating enzyme (E2) in a microarray screen for mitotic regulatory proteins. Its gene is mapped to 15q24.2. UBE2Q2 can covalently bind ubiquitin on the active site cysteine within the UBC domain. Inhibition of UBE2Q2 in HeLa cells causes an early mitotic arrest and increases cytotoxicity when the cells are treated with microtubule-inhibiting agents (MIAs). Changes in cell cycle progression and viability are not observed in the absence of MIA treatment, indicating that UBE2Q2 is involved in the response to MIAs rather than performing a more general function in mitosis. Moreover, inhibition of the UBE2Q2 protein causes cells to undergo a prolonged prophase arrest, suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint. Finally, inhibition of UBE2Q2 also sensitizes cells to the cytotoxic effects of MIAs through caspase-mediated apoptosis that is correlated with PARP1 cleavage. Applications: Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Versandbedingungen:: Blue Ice