353261
GAL4 (Galectin 4, Antigen NY CO 27, Antigen NY-CO-27, Antigen NYCO27, Gal-4, GAL4, Galectin 4, Galectin-4, L36LBP, LGALS4)
Größe
£620.00
- SKU:
- 353261
- Anwendung:
- WB
- Reinheit:
- Purified by immunoaffinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa283-320, DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY of human GAL4 at C-terminal, different from the related mouse and rat sequences by 7aa.
- Format:
- Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
- Weitere Details:
- Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323aa LGALS4 protein contains 2 homologous, approximately 150aa carbohydrate recognition domains and all amino acids typically conserved in galectins. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice