352818
DARPP32 (PPP1R1B, Protein Phosphatase 1 Regulatory Subunit 1B, Protein Phosphatase 1 Regulatory Inhibitor Subunit 1B, DARPP-32, PPR1B, DARPP 32)
Größe
£620.00
- SKU:
- 352818
- Reinheit:
- Purified by immunoaffinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa1-36 MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA of human DARPP32 at N-terminal.
- Format:
- Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
- Weitere Details:
- Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. Applications: Suitable for use in Western Blot, mmunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5g/ml Immunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice