298287
Thymosin B15, Human, aa1-45
Größe
£448.00
- SKU:
- 298287
- Reinheit:
- ≥95% (HPLC)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.
- Weitere Details:
- Synthetic human Thymosin B15, aa1-45 AA Sequence: MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVKRS Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile 0.1% acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice