298286
Thymosin B15 (NB Thymosin beta, Thymosin-Like Protein 8, TMSB15A, TMSL8, TMSNB) (Not for Export EU)
Größe
£298.00
- SKU:
- 298286
- Reinheit:
- Serum
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa1-45, MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVKRS, of human Thymosin B15, KLH conjugated.
- Format:
- Supplied as a lyophilized powder. Reconstitute with sterile ddH2O.
- Weitere Details:
- Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: ELISA: 1:80,000 Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice