Oxyntomodulin

Größe

£634.00

SKU:: 256135
Molekulargewicht:: 4421.86
Reinheit:: ~81% NPC
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
CAS Number:: 62340-29-8
Format:: White to off-white solid
Weitere Details:: Oxyntomodulin (porcine, bovine) is a GLP-1 receptor agonist. Endogenous preproglucagon-derived neuropeptide that modulates feeding and metabolism. Also secreted by intestinal L-cells. Increases cAMP production and inhibits gastric acid secretion in rat stomach. Also weak glucagon receptor agonist. Synonyms: Glucagon (1-37); Enteroglucagon CAS No: 62340-29-8 Molecular Formula: C192H295N59O60S Molecular Weight: 4421.86 Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA Appearance: White to off-white solid Purity: ~81% NPC Solubility: Water: 1mg/ml Storage and Stability: May be stored at RT for short-term only. Long-term storage is recommended at -20°C. For maximum recovery of product, centrifuge the original vial prior to removing the cap.