253904-BIOTIN

ZSCAN21 (Zinc Finger and SCAN Domain Containing 21, DKFZp434L134, DKFZp686H10254, NY-REN-21, ZNF38, Zipro1) (Biotin)

Größe

£914.00

SKU:: 253904-BIOTIN
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: ZSCAN21 (NP_666019, 136aa-224aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2A8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: Mouse monoclonal antibody raised against a full length recombinant ZSCAN21. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDI Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.